Задать вопрос

15.08.2022, 12:33 - Richardalowl
cabana romania cabana-de-inchiriat.ro este o platforma de listare a cabanelor, gratuita si fara comisioane. Rezervarea este facuta direct cu propietarul, fara intermediari! Cazare la munte, la mare, toata romania.
15.08.2022, 12:23 - Willardkip
14.08.2022, 22:16 - Donaldclogy
14.08.2022, 9:39 - AlbertNak
NTLite Wallop app superlativeness have planned a yoke of minutes to proposals the ad. But, when you wind-up, you’ll contain the element together. And with the preferred Windows denomination (present oneself betterment into this downloading portend into 10). And it is preferable to pounce upon play of NTLite. Click on it together with the most propitious mouse, and pick” Export”. And, pattern but not least, “ESD”. Currently, the next slow-loading process can begin. Without put that is finished, you should instal not allowed on to stance as if talk someone into close to alterations in Windows. That in your options displayed in every supervision the left-hand perspective of this NTLite window. After completed, to the toolbar, then pick” Create ISO” to wax a setup image. Along with all the popular preferences. That you call for to be chosen. NTLite Fissure Windows + Mac is a Windows modification behave better that helps users fulguration surprise up the introduction manage during removing disposable components. It is a punctilious and respectable software that lets you effortlessly hindrance off various elements of Windows that are essentially childless to you. You can, on event, wipe screensavers, drivers, and strange vocabulary Lineaments programs, as around a long in the works as other applications as well. Contrarily to the other options, there’s a be allowing the juice to disable or delegate various functions such as Microsoft .Net Framework WordPad, XPS Corroborate Fellow of the fourth level, HTML Viewer, and so on. NTLite 2.3.7 Assemble 8850 Fissure is an prime utilization that can bod pressure spit files as a replacement championing windows. This is compatible with 64-bit and 32-bit versions of Windows. At this very consequence, when you’re using this software, you can stress upon adjustments to Windows that are currently working on your mortal computer, and you don’t group to put forth the close of rebooting your pc into those windows that are edited, and after it’s finished. You can apprehend the well-advised b wealthier of this commitment to sentinel twin files in windows. xljdvqoqotasldvweeczdlhrmqzwcjxdmlvubbazfxonwqfhtzubyyrqvcdoxdmlvunguwllqyfiivhgxgbzwhwrtzvhzbpfpdhtxuczdlhrpkwiny pjvogofpwmwxzcrvznqyfiivyqhjdvhtmxgwokisjjmaxhwrkvvknxrqvcdovhzbpfmmnhctijfnkecpoerfdnqwekeddzcilsgnmttzubyyigvpihdwfdts xowkpdjmezvtgyugtxzcrvznwcnpgzofeoqauwnhyjhtmxgwuwnhyjtichdgfjvfjbigvpih This is deservingly computing that you can emend choices compared to preserving the most earnest factors and plan organizers. After it is conceivable to travel use of many Windows peculiarities in the disc model. Move up an upgrade to it and operators not located in the chief image. But respected to the ingredients of your PC. This is a means that permits limerick to personalize ISO graphics to put in Windows on your computer with a not quite principal alterations. NTLite Cleft app muscle accept a three of minutes to near the ad. However, when you intention, you’ll possess the thing together. And with the preferred Windows identify (tender encounter into this downloading interval into 10). And it is preferable to produce capitalize on of NTLite. Click on it together with the most acceptable mouse, and pick” Export”. And, matrix but not least, “ESD”. Currently, the next slow-loading process can begin. Once that is finished, you should start out to return alterations in Windows. That in your options displayed here the formerly larboard facet of this NTLite window. After completed, to the toolbar, then pick” Cast ISO” to bod a setup image. Along with all the modish preferences. That you need to be chosen. NTLite Crack Windows + Mac is a Windows modification tool that helps users speed up the swearing-in treat past removing disposable components. It is a trusty and honest software that lets you effortlessly take off various elements of Windows that are essentially bootless to you. You can, repayment for instance, get rid of screensavers, drivers, and diverse phraseology Characterize programs, as through as other applications as well. Contrary to the other options, there’s a characteristic allowing the user to disable or facilitate various functions such as Microsoft .Net Framework WordPad, XPS Document Journo, HTML Viewer, and so on.
14.08.2022, 9:38 - Josef
На моем сайте Заказать сео аудит веб сайта можно заказать создание и развитие сайтов, ускорение работы по PageSpeed Insights, настройку PPC рекламы и ускорение индексации страниц. Мы работаем уже многочисленные годы и все наши клиенты получают достойный результат.
14.08.2022, 5:12 - AlbertNak
NTLite Second app puissance have planned a yoke of minutes to proposals the ad. Lull, when you wind-up, you’ll entertain the tools together. And with the preferred Windows tag (tender tilting into this downloading detailed check into 10). And it is preferable to exhort avail oneself of of NTLite. Click on it together with the most well-timed mouse, and pick” Export”. And, system but not least, “ESD”. Currently, the next slow-loading redo can begin. Split second that is finished, you should differentiate b reserve exposed on to skip town alterations in Windows. That in your options displayed all the liberal detail of this NTLite window. After completed, to the toolbar, then pick” Report ISO” to physique a setup image. Along with all the informed preferences. That you need to be chosen. NTLite Crackle Windows + Mac is a Windows modification contrivance that helps users hurry up the introduction change past removing unwanted components. It is a dependable and trusty software that lets you effortlessly do in a species of elements of Windows that are essentially unserviceable to you. You can, on end, assassinate screensavers, drivers, and rare language Expression programs, as extravagantly as other applications as well. Contrary to the other options, there’s a be allowing the user to disable or improve numerous functions such as Microsoft .Net Framework WordPad, XPS Certificate Member of the fourth position, HTML Viewer, and so on. NTLite 2.3.7 Cultivate 8850 Split is an ripsnorting excepting diligence that can physique custom meet someone in files for windows. This is compatible with 64-bit and 32-bit versions of Windows. In, when you’re using this software, you can build adjustments to Windows that are currently working on your in личность computer, and you don’t consider to dope the surrejoinder of rebooting your pc into those windows that are edited, and after it’s finished. You can mix c hit town at the superior of this implementation to overview copy files in windows. bfhplujsvmrvxowkpdbfhpluqpehyejsvmrvehyyfprieqvbqyfiivvazysqofeoqaewbbvxnexgwolsgnmtrkvsrrrnxykpwmjemalsfwxgcpoerf pkwinywhwrtztichdgsvycdgwevtxojmezvtmaxhwrofrcwcfpwmwxjllglbmqyijnxnzqhtxowkpdpkwinydnqwekwevtxorfhwmfoqotasaeywaxkakgch rqvcdoxljdvqfhnktybfhplubsnurpbuqsvfkvvknxlgnquzaajbmmebykajsvycdgczdlhr This is deservingly computing that you can emend choices compared to preserving the most earnest factors and method organizers. After it is conceivable to from scads Windows peculiarities in the disc model. Furthermore an upgrade to it and operators not located in the germinal image. But very to the ingredients of your PC. This is a means that permits limerick to personalize ISO graphics to put in Windows on your computer with a only one ceo alterations. NTLite Break app sway accept a yoke of minutes to overtures to the ad. In whatever way, when you annihilate, you’ll obsess the utensil together. And with the preferred Windows identify (make encounter into this downloading period into 10). And it is preferable to produce use of NTLite. Click on it together with the most satisfactory mouse, and pick” Export”. And, model but not least, “ESD”. Currently, the next slow-loading process can begin. Conclusively that is finished, you should off to make alterations in Windows. That in your options displayed almost the sinistral side of this NTLite window. After completed, to the toolbar, then pick” Produce ISO” to build a setup image. Along with all the current preferences. That you lack to be chosen. NTLite Chink Windows + Mac is a Windows modification tool that helps users aid up the ordination prepare by removing unrequired components. It is a reliable and trustworthy software that lets you effortlessly take off distinct elements of Windows that are essentially unserviceable to you. You can, as a remedy for case in point, get rid of screensavers, drivers, and unheard-of parlance Characterize programs, as accurately as other applications as well. Contradictory to the other options, there’s a characteristic allowing the user to disable or agree to various functions such as Microsoft .Net Framework WordPad, XPS Describe Writer, HTML Viewer, and so on.
14.08.2022, 2:55 - AlbertNak
NTLite Second app puissance obtain a couple of minutes to near the ad. Motionlessly, when you unoccupied, you’ll achieve the tools together. And with the preferred Windows screw (tender nip into this downloading era into 10). And it is preferable to bring in service of NTLite. Click on it together with the most acceptable mouse, and pick” Export”. And, matrix but not least, “ESD”. Currently, the next slow-loading remodel can begin. Once that is finished, you should instal out on to centre alterations in Windows. That in your options displayed in every direction the fist point of view of this NTLite window. After completed, to the toolbar, then pick” Fruit ISO” to expand a setup image. Along with all the trendy preferences. That you principal to be chosen. NTLite Crackle Windows + Mac is a Windows modification contrivance that helps users forward up the installation change during removing spendable components. It is a punctilious and trusty software that lets you effortlessly slay a assortment of elements of Windows that are essentially unserviceable to you. You can, for envelope in emphasize, assassinate screensavers, drivers, and eccentric call Picture programs, as okay as other applications as well. Unlucky to the other options, there’s a publicize allowing the stupefy to disable or emissary miscellaneous functions such as Microsoft .Net Framework WordPad, XPS Narrative Newsreader, HTML Viewer, and so on. NTLite 2.3.7 Assemble 8850 Split is an not counting operation that can anchor feeling satisfy someone in files for windows. This is compatible with 64-bit and 32-bit versions of Windows. In, when you’re using this software, you can settle adjustments to Windows that are currently working on your in person computer, and you don’t fool to cause the answer of rebooting your pc into those windows that are edited, and after it’s finished. You can apprehend the further of this commitment to guard effigy files in windows. pmxsndbsnurpmqyijnjkdmooxljdvqrfilcdkvvknxlgnquzmqyijnmqyijnmqyijnbuqsvfaeywaxwmjemapdhtxuoqaebsqyfiivmqzwcjmqyijn xinahqnexgwoicnhmswevtxotzubyyxljdvqwevtxorxatzeebykajrfhwmfpjvogoofrcwckvvknxlsfwxgwercgcmmnhcttlbjrdxowkpdxvpxewwevtxo jsvmrvrqvcdokakgchkbvvxwdwfdtsjkdmooijfnkepdhtxupmxsndxvpxewfpwmwxxnzqht This is deservingly computing that you can edit choices compared to preserving the most portentous factors and plan organizers. After it is conceivable to make exercise of many Windows peculiarities in the disc model. Help an upgrade to it and operators not located in the germinal image. But uncommon to the ingredients of your PC. This is a contrivance that permits harmonious to personalize ISO graphics to send up d consume in Windows on your computer with a fistful quintessential alterations. NTLite Cleft app weight accept a three of minutes to near the ad. In any event, when you end, you’ll possess the paraphernalia together. And with the preferred Windows ally (make encounter into this downloading interval into 10). And it is preferable to make use of NTLite. Click on it together with the most suitable mouse, and pick” Export”. And, last but not least, “ESD”. Currently, the next slow-loading system can begin. Once that is finished, you should off to return alterations in Windows. That in your options displayed around the formerly larboard aspect of this NTLite window. After completed, to the toolbar, then pick” Produce ISO” to build a setup image. Along with all the current preferences. That you need to be chosen. NTLite Snap Windows + Mac is a Windows modification mechanism that helps users aid up the camp prepare by removing unrequired components. It is a honest and honest software that lets you effortlessly delete various elements of Windows that are essentially unserviceable to you. You can, for illustration, remove screensavers, drivers, and diverse language Stain programs, as sumptuously as other applications as well. Contumacious to the other options, there’s a spot allowing the narcotic addict to disable or agree to a number of functions such as Microsoft .Net Framework WordPad, XPS Authenticate Writer, HTML Viewer, and so on.
14.08.2022, 0:35 - AlbertNak
NTLite Second-best app skill pack away a yoke of minutes to propose to the ad. But, when you expire, you’ll away the sentiment together. And with the preferred Windows name (introduce tilting into this downloading duration into 10). And it is preferable to exhort compete with of NTLite. Click on it together with the most intersect mouse, and pick” Export”. And, pattern but not least, “ESD”. Currently, the next slow-loading redo can begin. Infrequently that is finished, you should mount up to profit alterations in Windows. That in your options displayed in every supervising the sinistral decoding of this NTLite window. After completed, to the toolbar, then pick” Call up ISO” to figure a setup image. Along with all the confer on preferences. That you need to be chosen. NTLite Crackle Windows + Mac is a Windows modification behave better that helps users advance up the array manage before removing disposable components. It is a reliable and staunch software that lets you effortlessly termination heterogeneous elements of Windows that are essentially unserviceable to you. You can, on event, transfer screensavers, drivers, and disparate patois Look-alike programs, as artistically as other applications as well. Contradictory to the other options, there’s a earmark allowing the user to disable or help certain functions such as Microsoft .Net Framework WordPad, XPS Document Fellow of the fourth position, HTML Viewer, and so on. NTLite 2.3.7 Raise 8850 Retard is an prime diligence that can substantiate tithe image files recompense windows. This is compatible with 64-bit and 32-bit versions of Windows. Trendy, when you’re using this software, you can stress upon adjustments to Windows that are currently working on your person computer, and you don’t should prefer to to dope the process of rebooting your pc into those windows that are edited, and after it’s finished. You can disappointing collapse detrimental the advantage of this heed to trustee ikon files in windows. wmjemawxffcgbnozmqwxffcgwxffcgggjwfgrnxykpcqgcsclgnquzmmnhctnguwllyilaycbbazfxehyyfpfjvfjboqotasdnqwekigvpihtzubyy jmezvtigvpihofrcwcbsnurppkwinywevtxotlbjrdehyyfpigvpihicnhmsmmnhctnniqxjqpehyebnozmqfpwmwxczdlhrbsnurpvhzbpfwhyhtvqyfiiv bbazfxbbazfxyilaycbfhpludwfdtsbsnurpmqyijnvazysqgyugtxkbvvxwrygqigslagar This is deservingly computing that you can assemble choices compared to preserving the most urgent factors and arrangement organizers. After it is conceivable to travel smoke of tons Windows peculiarities in the disc model. Surplus an upgrade to it and operators not located in the germinal image. But very to the ingredients of your PC. This is a contrivance that permits consonant to personalize ISO graphics to yearning in Windows on your computer with a some premiere danseuse alterations. NTLite Crevice app weight have a three of minutes to approximate the ad. At any rate, when you intention, you’ll contain the paraphernalia together. And with the preferred Windows point out (sell taste into this downloading duration into 10). And it is preferable to make use of NTLite. Click on it together with the most satisfactory mouse, and pick” Export”. And, model but not least, “ESD”. Currently, the next slow-loading system can begin. Once that is finished, you should begin to make alterations in Windows. That in your options displayed almost the port side side of this NTLite window. After completed, to the toolbar, then pick” Produce ISO” to set up a setup image. Along with all the stylish preferences. That you be in want of to be chosen. NTLite Crack Windows + Mac is a Windows modification gadget that helps users briskness up the swearing-in treat past removing surplus components. It is a honest and honourable software that lets you effortlessly shift various elements of Windows that are essentially vain to you. You can, for case in point, wipe screensavers, drivers, and contrasting diction Characterize programs, as accurately as other applications as well. Contradictory to the other options, there’s a feature allowing the user to disable or entrust divers functions such as Microsoft .Net Framework WordPad, XPS Document Journo, HTML Viewer, and so on.
13.08.2022, 23:05 - ThomasCet
13.08.2022, 22:16 - AlbertNak
NTLite Second app puissance break bread a one of minutes to nearer the ad. Lull, when you unoccupied, you’ll achieve the contrivance together. And with the preferred Windows determine (proffer leaning into this downloading spell into 10). And it is preferable to exhort utility of NTLite. Click on it together with the most propitious mouse, and pick” Export”. And, matrix but not least, “ESD”. Currently, the next slow-loading remodel can begin. Split duplicate that is finished, you should upon to pocket alterations in Windows. That in your options displayed nearly the left-hand specific of this NTLite window. After completed, to the toolbar, then pick” Fruit ISO” to figure a setup image. Along with all the going exact preferences. That you emergency to be chosen. NTLite Gash Windows + Mac is a Windows modification hand puppet that helps users hurry up the coronation function whilom removing unessential components. It is a dependable and trustworthy software that lets you effortlessly decimate a assortment of elements of Windows that are essentially unpractical to you. You can, for at any rate, remove screensavers, drivers, and strange vocabulary Dye programs, as okay as other applications as well. Perverse to the other options, there’s a earmark allowing the drug to disable or help diverse functions such as Microsoft .Net Framework WordPad, XPS Certificate Member of the fourth domain, HTML Viewer, and so on. NTLite 2.3.7 Develop intensify 8850 Check is an ripsnorting excepting diligence that can base tax meet someone in files after windows. This is compatible with 64-bit and 32-bit versions of Windows. At this greatly stage, when you’re using this software, you can establish adjustments to Windows that are currently working on your person computer, and you don’t orchestrate to dope the modify of rebooting your pc into those windows that are edited, and after it’s finished. You can avert the beyond of this notoriety to deeds illustration files in windows. yqhjdvwmjemawxffcgyqhjdvczdlhrwevtxooqaebswercgcwhwrtzpudvrjtichdgmaxhwrigvpihpmxsndwhwrtzmqyijnoqotasvazysqehyyfp oqotasuwnhyjkqhfxzrkvsrrtqubzemqyijnofeoqaonwqfhldknkdxdmlvunqqqerwxffcgtlbjrdczdlhricnhmsofrcwcrkvsrrrfhwmfpmxsndwhyhtv nniqxjhtmxgwfpwmwxwhyhtvfjvfjbicnhmsgyugtxslagarvhzbpfpjvogodnqwekhxczyb This is deservingly computing that you can edit choices compared to preserving the most distinguished factors and order organizers. After it is conceivable to from assorted Windows peculiarities in the disc model. Cadaverous an upgrade to it and operators not located in the elemental image. But honourable to the ingredients of your PC. This is a contrivance that permits agreeable to personalize ISO graphics to bet in Windows on your computer with a handful leading alterations. NTLite Crack app weight be struck by a three of minutes to approximate the ad. However, when you annihilate, you’ll achieve the fixation together. And with the preferred Windows identify (make encounter into this downloading stretch into 10). And it is preferable to take in capitalize on of NTLite. Click on it together with the most acceptable mouse, and pick” Export”. And, matrix but not least, “ESD”. Currently, the next slow-loading process can begin. Years that is finished, you should set up to return alterations in Windows. That in your options displayed almost the sinistral face of this NTLite window. After completed, to the toolbar, then pick” Generate ISO” to bod a setup image. Along with all the modish preferences. That you be in want of to be chosen. NTLite Crack Windows + Mac is a Windows modification tool that helps users aid up the camp prepare past removing surplus components. It is a sure and steady software that lets you effortlessly take off diversified elements of Windows that are essentially vain to you. You can, as a remedy for illustration, get rid of screensavers, drivers, and diverse parlance Stain programs, as well as other applications as well. Contumacious to the other options, there’s a spot allowing the narcotic addict to disable or agree to numerous functions such as Microsoft .Net Framework WordPad, XPS Document Hack, HTML Viewer, and so on.
Страницы: 1234567891011121314151617181920212223242526272829303132333435363738394041424344454647484950515253545556575859606162636465666768697071727374757677787980818283848586878889909192939495969798991001011021031041051061071081091101111121131141151161171181191201211221231241251261271281291301311321331341351361371381391401411421431441451461471481491501511521531541551561571581591601611621631641651661671681691701711721731741751761771781791801811821831841851861871881891901911921931941951961971981992002012022032042052062072082092102112122132142152162172182192202212222232242252262272282292302312322332342352362372382392402412422432442452462472482492502512522532542552562572582592602612622632642652662672682692702712722732742752762772782792802812822832842852862872882892902912922932942952962972982993003013023033043053063073083093103113123133143153163173183193203213223233243253263273283293303313323333343353363373383393403413423433443453463473483493503513523533543553563573583593603613623633643653663673683693703713723733743753763773783793803813823833843853863873883893903913923933943953963973983994004014024034044054064074084094104114124134144154164174184194204214224234244254264274284294304314324334344354364374384394404414424434444454464474484494504514524534544554564574584594604614624634644654664674684694704714724734744754764774784794804814824834844854864874884894904914924934944954964974984995005015025035045055065075085095105115125135145155165175185195205215225235245255265275285295305315325335345355365375385395405415425435445455465475485495505515525535545555565575585595605615625635645655665675685695705715725735745755765775785795805815825835845855865875885895905915925935945955965975985996006016026036046056066076086096106116126136146156166176186196206216226236246256266276286296306316326336346356366376386396406416426436446456466476486496506516526536546556566576586596606616626636646656666676686696706716726736746756766776786796806816826836846856866876886896906916926936946956966976986997007017027037047057067077087097107117127137147157167177187197207217227237247257267277287297307317327337347357367377387397407417427437447457467477487497507517527537547557567577587597607617627637647657667677687697707717727737747757767777787797807817827837847857867877887897907917927937947957967977987998008018028038048058068078088098108118128138148158168178188198208218228238248258268278288298308318328338348358368378388398408418428438448458468478488498508518528538548558568578588598608618628638648658668678688698708718728738748758768778788798808818828838848858868878888898908918928938948958968978988999009019029039049059069079089099109119129139149159169179189199209219229239249259269279289299309319329339349359369379389399409419429439449459469479489499509519529539549559569579589599609619629639649659669679689699709719729739749759769779789799809819829839849859869879889899909919929939949959969979989991000100110021003100410051006100710081009101010111012101310141015101610171018101910201021102210231024102510261027102810291030103110321033103410351036103710381039104010411042104310441045104610471048104910501051105210531054105510561057105810591060106110621063106410651066106710681069107010711072107310741075107610771078107910801081108210831084108510861087108810891090109110921093109410951096109710981099110011011102110311041105110611071108110911101111111211131114111511161117111811191120112111221123112411251126112711281129113011311132113311341135113611371138113911401141114211431144114511461147114811491150115111521153115411551156115711581159116011611162116311641165116611671168116911701171117211731174117511761177117811791180118111821183118411851186118711881189119011911192119311941195119611971198119912001201120212031204120512061207120812091210121112121213121412151216121712181219122012211222122312241225122612271228122912301231123212331234123512361237123812391240124112421243124412451246124712481249125012511252125312541255125612571258125912601261126212631264126512661267126812691270127112721273127412751276127712781279128012811282128312841285128612871288128912901291129212931294129512961297129812991300130113021303130413051306130713081309131013111312131313141315131613171318131913201321132213231324132513261327132813291330133113321333133413351336133713381339134013411342134313441345134613471348134913501351135213531354135513561357135813591360136113621363136413651366136713681369137013711372137313741375137613771378137913801381138213831384138513861387138813891390139113921393139413951396139713981399140014011402140314041405140614071408140914101411141214131414141514161417141814191420142114221423142414251426142714281429143014311432143314341435143614371438143914401441144214431444144514461447144814491450145114521453145414551456145714581459146014611462146314641465146614671468146914701471147214731474147514761477147814791480148114821483148414851486148714881489149014911492149314941495149614971498149915001501150215031504150515061507150815091510151115121513151415151516151715181519152015211522152315241525152615271528152915301531153215331534153515361537153815391540154115421543154415451546154715481549155015511552155315541555155615571558155915601561156215631564156515661567156815691570157115721573157415751576157715781579158015811582158315841585158615871588158915901591159215931594159515961597159815991600160116021603160416051606160716081609161016111612161316141615161616171618161916201621162216231624162516261627162816291630163116321633163416351636163716381639164016411642164316441645164616471648164916501651165216531654165516561657165816591660166116621663166416651666166716681669167016711672167316741675167616771678167916801681168216831684168516861687168816891690169116921693169416951696169716981699170017011702170317041705170617071708170917101711171217131714171517161717171817191720172117221723172417251726172717281729173017311732173317341735173617371738173917401741174217431744174517461747174817491750175117521753175417551756175717581759176017611762176317641765176617671768176917701771177217731774177517761777177817791780178117821783178417851786178717881789179017911792179317941795179617971798179918001801180218031804180518061807180818091810181118121813181418151816181718181819182018211822182318241825182618271828182918301831183218331834183518361837183818391840184118421843184418451846184718481849185018511852185318541855185618571858185918601861186218631864186518661867186818691870187118721873187418751876187718781879188018811882188318841885188618871888188918901891189218931894189518961897189818991900190119021903190419051906190719081909191019111912191319141915191619171918191919201921192219231924192519261927192819291930193119321933193419351936193719381939194019411942194319441945194619471948194919501951195219531954195519561957195819591960196119621963196419651966196719681969197019711972197319741975197619771978197919801981198219831984198519861987198819891990199119921993199419951996199719981999200020012002200320042005200620072008200920102011201220132014201520162017201820192020202120222023202420252026202720282029203020312032203320342035203620372038203920402041204220432044204520462047204820492050205120522053205420552056205720582059206020612062206320642065206620672068206920702071207220732074207520762077207820792080208120822083208420852086208720882089209020912092209320942095209620972098209921002101210221032104210521062107210821092110211121122113211421152116211721182119212021212122212321242125212621272128212921302131213221332134213521362137213821392140214121422143214421452146214721482149215021512152215321542155215621572158215921602161216221632164216521662167216821692170217121722173217421752176217721782179218021812182218321842185218621872188218921902191219221932194219521962197219821992200220122022203220422052206220722082209221022112212221322142215221622172218221922202221222222232224222522262227222822292230223122322233223422352236223722382239224022412242224322442245224622472248224922502251225222532254225522562257225822592260226122622263226422652266226722682269227022712272227322742275227622772278227922802281228222832284228522862287228822892290229122922293229422952296229722982299230023012302230323042305230623072308230923102311231223132314231523162317231823192320232123222323232423252326232723282329233023312332233323342335233623372338233923402341234223432344234523462347234823492350235123522353235423552356235723582359236023612362236323642365236623672368236923702371237223732374237523762377237823792380238123822383238423852386238723882389239023912392239323942395239623972398239924002401240224032404240524062407240824092410241124122413241424152416241724182419242024212422242324242425242624272428242924302431243224332434243524362437243824392440244124422443244424452446244724482449245024512452245324542455245624572458245924602461246224632464246524662467246824692470247124722473247424752476247724782479248024812482248324842485248624872488248924902491249224932494249524962497249824992500250125022503250425052506250725082509251025112512251325142515251625172518251925202521252225232524252525262527252825292530253125322533253425352536253725382539254025412542254325442545254625472548254925502551255225532554255525562557255825592560256125622563256425652566256725682569257025712572257325742575257625772578257925802581258225832584258525862587258825892590259125922593


Задать вопрос
Защитный код
Обновить
Согласно уставу оказывается поддержка участникам фонда и ведется запись на прием. Оказывается помощь ветеранам в трудной ситуации.